Sequence 1: | NP_001261219.1 | Gene: | RabX6 / 38084 | FlyBaseID: | FBgn0035155 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017761.1 | Gene: | rab3ab / 550457 | ZFINID: | ZDB-GENE-041210-268 | Length: | 220 | Species: | Danio rerio |
Alignment Length: | 208 | Identity: | 64/208 - (30%) |
---|---|---|---|
Similarity: | 107/208 - (51%) | Gaps: | 15/208 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
Fly 75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138
Fly 139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAAT 203
Fly 204 NEEDAS---SCGC 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX6 | NP_001261219.1 | RAB | 10..176 | CDD:197555 | 53/166 (32%) |
Rab | 10..172 | CDD:206640 | 52/162 (32%) | ||
rab3ab | NP_001017761.1 | Rab3 | 22..186 | CDD:206657 | 54/171 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |