DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RAB4B

DIOPT Version :10

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_057238.3 Gene:RAB4B / 53916 HGNCID:9782 Length:213 Species:Homo sapiens


Alignment Length:55 Identity:13/55 - (23%)
Similarity:27/55 - (49%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GEE--FHNSFKKSKQEDQSQSTLFNERPKSESMRSITFDFELHLHTPLPSDWQTK 72
            |||  ||:. ..|.:|:|..:.:..::...||...:..::.:.|...:|.:.:.|
Human    58 GEEECFHDC-SASFEEEQPGAHMAGDKASDESSSELEEEYLIELEKNMPEEEKQK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 Rab 10..172 CDD:206640 13/55 (24%)
RAB4BNP_057238.3 Rab4 9..169 CDD:206696 13/55 (24%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P61106 39..44
Switch 2. /evidence=ECO:0000250|UniProtKB:P61106 65..74 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.