DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Rab43

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001019502.1 Gene:Rab43 / 500249 RGDID:1565300 Length:210 Species:Rattus norvegicus


Alignment Length:207 Identity:67/207 - (32%)
Similarity:109/207 - (52%) Gaps:17/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |::|.||..|||:.:.:||.|..|  ...:.||:|:|...:...:..|::|||:|||.|.||..:
  Rat    18 KLVLVGDASVGKTCVVQRFKTGAF--SARQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRT 80

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDL-DGREPEVSDEE 137
            :|.|||:.|.||||.:.:...::|.|:...:.|:..|| .|....:.|||||| |.||..::  |
  Rat    81 ITQSYYRSANGAILAYDISKRSTFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLADLREVPLA--E 143

  Fly   138 VEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKM-ELQALEHKSFQVDTASSGA 201
            .::..|  |..|....:||.:..:.|||.|..::.:|:..:...| ..:..:|  .|:|:.... 
  Rat   144 AQSLAE--HYDILCAIETSAKDSSNVEEAFTRVATELIMRHGGPMFSEKNTDH--IQLDSKDIA- 203

  Fly   202 ATNEEDASSCGC 213
                 ::..|||
  Rat   204 -----ESWGCGC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 60/167 (36%)
Rab 10..172 CDD:206640 59/163 (36%)
Rab43NP_001019502.1 Rab19 14..178 CDD:133267 59/165 (36%)
Effector region. /evidence=ECO:0000250 45..53 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.