DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and ran

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001004829.1 Gene:ran / 448091 XenbaseID:XB-GENE-489468 Length:216 Species:Xenopus tropicalis


Alignment Length:202 Identity:58/202 - (28%)
Similarity:97/202 - (48%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRK--STLGLDHIDREYSVNEKQIKLQLWDTGGMERV 72
            |::|.||.|.||::..:|..|..|    ::|  :|||::.....:..|...||..:|||.|.|:.
 Frog    12 KLVLVGDGGTGKTTFVKRHLTGEF----EKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKF 72

  Fly    73 ASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAENAKIFICGNKSDLDGREPEVSDEE 137
            ..:...||..|:.||::|.:.:..::.::.....|:|...||..|.:||||.|       :.|.:
 Frog    73 GGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVD-------IKDRK 130

  Fly   138 VEAFCEQCHSLISAT-YKTSCRSGAGVEEMFRDISRQLV-HANRSKMELQALEHKSFQVDTASSG 200
            |:|.....|...:.. |..|.:|....|:.|..::|:|: ..|...:.:.||......:|.|.  
 Frog   131 VKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNFEFVAMPALAPPEVVMDPAL-- 193

  Fly   201 AATNEED 207
            ||..|:|
 Frog   194 AAQYEQD 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 49/169 (29%)
Rab 10..172 CDD:206640 47/164 (29%)
ranNP_001004829.1 PTZ00132 1..216 CDD:240284 58/202 (29%)
Interaction with RANBP1. /evidence=ECO:0000250|UniProtKB:P62826 211..216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.