DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Rab18

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:211 Identity:69/211 - (32%)
Similarity:107/211 - (50%) Gaps:27/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |:::.|:.|||||||.|||..|.|  |.:...|:|:|...:...|:....|:.||||.|.||..|
  Fly     7 KLLVIGESGVGKSSLIRRFVENKF--DQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRS 69

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAENAK--IFICGNKSDLDGREPEVSDEE 137
            :|.|:|:.|.|||||:.:.:..|...|...|.::.:|::|..  |.:.|||.|   .|..|..||
  Fly    70 LTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKID---EERVVDREE 131

  Fly   138 VEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSG-- 200
            ...|..:..:|.   .:||.:....|.::|:|:..::|.:            :.|....||:|  
  Fly   132 GRKFARKHRALF---IETSAKCDQFVSDVFKDVVEKIVSS------------EYFNNGNASAGLD 181

  Fly   201 AATN---EEDASSCGC 213
            .|::   |..||:|.|
  Fly   182 IASDRDLEASASTCYC 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 58/167 (35%)
Rab 10..172 CDD:206640 58/163 (36%)
Rab18NP_524744.2 RAB 6..166 CDD:197555 58/166 (35%)
Rab18 6..165 CDD:206656 58/165 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.