DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RabX1

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster


Alignment Length:224 Identity:72/224 - (32%)
Similarity:107/224 - (47%) Gaps:16/224 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MRIPKQKVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGG 68
            ||..:.||::.|..||||:.|..|:..||.........|:.:........::|.:||||:|||.|
  Fly     1 MRGIEGKVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAG 65

  Fly    69 MERVASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAENAKIF-ICGNKSDLDGREPE 132
            .||..:|...||:.|..|||||.|....:|..:...:.::....::..|. :.|||.|:..:. .
  Fly    66 QERYRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQR-A 129

  Fly   133 VSDEEVEAFCEQCHSLISATY-KTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDT 196
            ||.||...|.    :.|.||| :||..:..|:|::|...::.||   |...|.::...:|||  :
  Fly   130 VSREEAFVFA----TSIGATYFETSTETDQGLEQVFISTAQGLV---RLADEGKSPSLRSFQ--S 185

  Fly   197 ASSGAATNEEDASSCGCXQL----GNIEF 221
            ..|.|.||...|.|.....|    ||..|
  Fly   186 TDSLAYTNTNTAFSHTVAALARSSGNAAF 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 54/167 (32%)
Rab 10..172 CDD:206640 53/163 (33%)
RabX1NP_524713.1 Ras 7..166 CDD:278499 53/163 (33%)
Rab 7..166 CDD:206640 53/163 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.