DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and rab11bb

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001002555.1 Gene:rab11bb / 436828 ZFINID:ZDB-GENE-040718-293 Length:218 Species:Danio rerio


Alignment Length:206 Identity:69/206 - (33%)
Similarity:107/206 - (51%) Gaps:17/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            ||:|.||.|||||:|..||..|.|  :.:.|||:|::...|...|:.|.||.|:|||.|.||..:
Zfish    13 KVVLIGDSGVGKSNLLSRFTRNEF--NLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRA 75

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138
            :||:||:.|.||:||:.:....::.::.:.|.::..:|: |..|.:.||||||.... .|..:|.
Zfish    76 ITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLR-AVPTDEA 139

  Fly   139 EAFCEQCH-SLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHK--------SFQV 194
            .||.|:.: |.|    :||......|||.|::|..::......|...:...|.        ...|
Zfish   140 RAFAEKNNLSFI----ETSALDSTNVEEAFKNILTEIYRIVSQKQIAERSAHDESPGNNVVDISV 200

  Fly   195 DTASSGAATNE 205
            ...:.|..:|:
Zfish   201 PPTTDGQKSNK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 64/167 (38%)
Rab 10..172 CDD:206640 64/163 (39%)
rab11bbNP_001002555.1 PLN03110 1..217 CDD:178657 69/206 (33%)
Rab11_like 9..173 CDD:206660 64/166 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.