DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and dnajc27

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001007163.1 Gene:dnajc27 / 402784 ZFINID:ZDB-GENE-081022-93 Length:273 Species:Danio rerio


Alignment Length:167 Identity:49/167 - (29%)
Similarity:82/167 - (49%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |||..|:..||||.:.:|:....|:  ....:|:|:|:...:..|.:::||:.::|..|......
Zfish    18 KVISLGNAEVGKSCIIKRYCEKRFV--PKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFYE 80

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDI------VTYAENAKIFICGNKSDLDGREPEV 133
            |.:.:||.::|.|||:.:....||.:|...|.::      ....||....:|.||.||..|. .|
Zfish    81 VRNEFYKDSQGVILVYDVGLRESFDALDSWLTEMKQEMGSQANMENIIFVVCANKVDLTKRR-VV 144

  Fly   134 SDEEVEAFCEQ--CHSLISATYKTSCRSGAGVEEMFR 168
            .:.|...:.|.  .|     .::||.:||.|:.|||:
Zfish   145 DESEGRLWAESRGFH-----YFETSAQSGEGINEMFQ 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 49/167 (29%)
Rab 10..172 CDD:206640 49/167 (29%)
dnajc27NP_001007163.1 RJL 17..184 CDD:133319 49/167 (29%)
RAB 17..176 CDD:197555 48/165 (29%)
DnaJ 217..264 CDD:99751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.