DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and rab1ba

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_957436.1 Gene:rab1ba / 394117 ZFINID:ZDB-GENE-040426-873 Length:201 Species:Danio rerio


Alignment Length:166 Identity:62/166 - (37%)
Similarity:98/166 - (59%) Gaps:7/166 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |::|.||.|||||.|..|||.:|: |:: ..||:|:|...|...::.|.||||:|||.|.||..:
Zfish    10 KLLLIGDSGVGKSCLLLRFADDTY-TES-YISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRT 72

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138
            :|||||:.|.|.|:|:.:.:..|::::.|.|.:|..|| ||....:.|||.||..:: .|.....
Zfish    73 ITSSYYRGAHGIIVVYDVTDQESYNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKK-VVDYTTA 136

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQL 174
            :.|.:   ||.....:||.::...||:.|..::.::
Zfish   137 KEFAD---SLAIPFLETSAKNATNVEQAFMTMAAEI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 62/166 (37%)
Rab 10..172 CDD:206640 62/162 (38%)
rab1baNP_957436.1 Rab1_Ypt1 7..172 CDD:206661 62/166 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.