DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Rap1

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster


Alignment Length:167 Identity:46/167 - (27%)
Similarity:84/167 - (50%) Gaps:9/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |:::.|..|||||:|..:|....|:...|  .|:. |...::..|:.:|..|::.||.|.|:..:
  Fly     5 KIVVLGSGGVGKSALTVQFVQCIFVEKYD--PTIE-DSYRKQVEVDGQQCMLEILDTAGTEQFTA 66

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDI--VTYAENAKIFICGNKSDLDGREPEVSDEE 137
            :...|.|..:|.:||:::...::|:.|......|  |...::..:.:.|||.||: .|..|..|.
  Fly    67 MRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLE-EERVVGKEL 130

  Fly   138 VEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQL 174
            .:....|.:   .|..:||.::...|.::|.|:.||:
  Fly   131 GKNLATQFN---CAFMETSAKAKVNVNDIFYDLVRQI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 46/167 (28%)
Rab 10..172 CDD:206640 44/163 (27%)
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 46/167 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.