DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Rab32

DIOPT Version :10

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:222 Identity:54/222 - (24%)
Similarity:101/222 - (45%) Gaps:38/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDR--EYSVNEKQIKLQLWDTGGMERV 72
            |:::.|:.|.||:|..:|:....|  ..:.::|:|:|...:  ::..| ..::|||||..|.||.
  Fly   485 KILVIGELGTGKTSFIKRYVHQFF--SQNYRATIGVDFALKVLQWDAN-TIVRLQLWDIAGQERF 546

  Fly    73 ASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDI---VTYAENAKI--FICGNKSDLDGR--- 129
            .::|..|||.|.||.:||.:..:.:|..:|:...|:   |...:.:.|  .:..||.|.:.:   
  Fly   547 GNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGII 611

  Fly   130 -EPEVSDEEVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQ 193
             :||..||.|.      .:..:..::||.:....::|..|.:..:::           :..|...
  Fly   612 TQPEKMDEYVR------ENGFAGWFETSAKENINIDEAARALVNKIL-----------INDKLIS 659

  Fly   194 VDTA-------SSGAATNEEDASSCGC 213
            .|.|       |:..||..:..:.|.|
  Fly   660 ADLADGDKFNLSAADATGSDAKNKCSC 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 Rab 10..172 CDD:206640 46/172 (27%)
Rab32NP_525109.1 PHA03247 <126..481 CDD:223021
Rab32_Rab38 484..686 CDD:206692 53/220 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.