DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Rab32

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:222 Identity:54/222 - (24%)
Similarity:101/222 - (45%) Gaps:38/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDR--EYSVNEKQIKLQLWDTGGMERV 72
            |:::.|:.|.||:|..:|:....|  ..:.::|:|:|...:  ::..| ..::|||||..|.||.
  Fly   485 KILVIGELGTGKTSFIKRYVHQFF--SQNYRATIGVDFALKVLQWDAN-TIVRLQLWDIAGQERF 546

  Fly    73 ASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDI---VTYAENAKI--FICGNKSDLDGR--- 129
            .::|..|||.|.||.:||.:..:.:|..:|:...|:   |...:.:.|  .:..||.|.:.:   
  Fly   547 GNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGII 611

  Fly   130 -EPEVSDEEVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQ 193
             :||..||.|.      .:..:..::||.:....::|..|.:..:::           :..|...
  Fly   612 TQPEKMDEYVR------ENGFAGWFETSAKENINIDEAARALVNKIL-----------INDKLIS 659

  Fly   194 VDTA-------SSGAATNEEDASSCGC 213
            .|.|       |:..||..:..:.|.|
  Fly   660 ADLADGDKFNLSAADATGSDAKNKCSC 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 46/176 (26%)
Rab 10..172 CDD:206640 46/172 (27%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 53/220 (24%)
RAB 484..652 CDD:197555 46/175 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.