DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and CenG1A

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster


Alignment Length:176 Identity:34/176 - (19%)
Similarity:80/176 - (45%) Gaps:20/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IPKQKVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGME 70
            :|..::.:.|....|||:|..|:.|.:::.:...:.    ....:|..::.:...|.:.|.||..
  Fly   140 VPDLRLGIVGSLNSGKSALVHRYLTGSYMQEESPEG----GRFKKEVFIDGQSYLLLIRDEGGAP 200

  Fly    71 RVASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAENAKI--FICGNKSDLDGREPEV 133
            .:     .:..:.:..|.||:|:|..||:::..:...:..:....:|  .:.|.:..:..|.|.|
  Fly   201 EM-----QFAGWVDAVIFVFSLENEGSFNTVYNYYTKMAHFRNGQEIPMILVGTQDAISERNPRV 260

  Fly   134 SDE----EVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLV 175
            .|:    ::.:..::|     :.|:|....|..||.:|:|..::::
  Fly   261 IDDTRARKLASDLKRC-----SYYETCATYGLNVERVFQDACQKIL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 33/172 (19%)
Rab 10..172 CDD:206640 33/167 (20%)
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303 33/170 (19%)
RAS 144..295 CDD:214541 32/164 (20%)
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720
ANK <834..907 CDD:238125
ANK repeat 834..866 CDD:293786
Ank_5 859..907 CDD:290568
ANK repeat 868..897 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2762
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.