DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Rab30

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster


Alignment Length:205 Identity:71/205 - (34%)
Similarity:111/205 - (54%) Gaps:20/205 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |::|.|:.||||:.|.|||....|  ...:.:|:|:|.:.:...|..::||||:|||.|.||..|
  Fly     9 KIVLVGNAGVGKTCLVRRFTQGLF--PPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQERFRS 71

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAENAKI--FICGNKSDLDGREPEVSDEE 137
            :|.|||:.|...|||:.:....:|..|...|.:|..|| |:|:  .:.|||:|.|.|  |:..:.
  Fly    72 ITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYA-NSKVLKILVGNKTDRDDR--EIPTQI 133

  Fly   138 VEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAA 202
            .|.|.:| |.:.  ..:||.:....||.:|.:|:.:|:...|||      :..|    :|::.||
  Fly   134 GEEFAKQ-HDMY--FLETSAKEAENVERLFYEIAAELIGQARSK------DGSS----SAAAAAA 185

  Fly   203 TNEEDASSCG 212
            ..:.:.||.|
  Fly   186 QRQSEGSSIG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 61/167 (37%)
Rab 10..172 CDD:206640 60/163 (37%)
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 60/166 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.