DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and CG4789

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster


Alignment Length:207 Identity:49/207 - (23%)
Similarity:72/207 - (34%) Gaps:67/207 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKS-TLGLD-----HIDREYSVNEKQIKLQLWDTGG 68
            ::::.||.||||:||......|..:.   |.. |:|.:     |..||.:..|....::|:|.||
  Fly     8 RIVVVGDSGVGKTSLTHLITHNEALI---RPGWTVGCNIQVKMHPFREGTARECPYFVELFDVGG 69

  Fly    69 MERVASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTY---------------------- 111
            .....:..|.:|...:|.|||..|.||.|...|...|.:||..                      
  Fly    70 SLNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSPLS 134

  Fly   112 ----------------------AENAKIFICGNKSDL--DGREPE--------VSD----EEVEA 140
                                  |....|.:.|.|.||  :.|.|:        ::|    ||:..
  Fly   135 SFSTDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKRHPKMGVKKPGGIADKCGAEEIWL 199

  Fly   141 FCEQCHSLISAT 152
            .|....||.:.|
  Fly   200 NCRNSRSLAAGT 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 49/207 (24%)
Rab 10..172 CDD:206640 49/207 (24%)
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 49/207 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.