DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RAB37

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001157461.1 Gene:RAB37 / 326624 HGNCID:30268 Length:228 Species:Homo sapiens


Alignment Length:220 Identity:69/220 - (31%)
Similarity:117/220 - (53%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TMR--IP--KQKVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQL 63
            |:|  :|  ..||:|.||.||||:....:|....|::.| ..:|:|:|..::..:|:..::|||:
Human    25 TLRLCVPSGNSKVMLLGDTGVGKTCFLIQFKDGAFLSGT-FIATVGIDFRNKVVTVDGVRVKLQI 88

  Fly    64 WDTGGMERVASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLD 127
            |||.|.||..|||.:||:.|:..:|::.:.|.:||.::...|.:|..||: :..|.:.|||:|:.
Human    89 WDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADMS 153

  Fly   128 GREPEVSDEEVEAFCEQCHSLISATY-----KTSCRSGAGVEEMFRDISRQLVHANRSKMELQAL 187
            . |..:..|:.|....:        |     :||.::|..||..|..|:::|    :.:...|| 
Human   154 S-ERVIRSEDGETLARE--------YGVPFLETSAKTGMNVELAFLAIAKEL----KYRAGHQA- 204

  Fly   188 EHKSFQV-DTASSGAATNEEDASSC 211
            :..|||: |...|     ::..|||
Human   205 DEPSFQIRDYVES-----QKKRSSC 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 56/171 (33%)
Rab 10..172 CDD:206640 55/167 (33%)
RAB37NP_001157461.1 Rab26 36..225 CDD:206695 66/209 (32%)
RAB 36..197 CDD:197555 56/174 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.