DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Dnajc27

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_996727.2 Gene:Dnajc27 / 298859 RGDID:1564414 Length:273 Species:Rattus norvegicus


Alignment Length:222 Identity:56/222 - (25%)
Similarity:99/222 - (44%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IPKQ---------KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKL 61
            :||:         |||..|:..||||.:.:|:....|:  :...:|:|:|:...:..|.:::||:
  Rat     5 VPKRKEPLKSLRIKVISMGNAEVGKSCIIKRYCEKRFV--SKYLATIGIDYGVTKVQVRDREIKV 67

  Fly    62 QLWDTGGMERVASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVT------YAENAKIFIC 120
            .::|..|......|.:.:||..:|.|||:.:....||.:|...|.::..      ..||....:|
  Rat    68 NIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMENIVFVVC 132

  Fly   121 GNKSDLDGREPEVSDEEVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVH--ANRSKME 183
            .||.|. .:...:.:.|...:.|....|.   ::||.::|.|:.|||:.....:|.  .|..|. 
  Rat   133 ANKIDC-SKHRCIDESEGRLWAESRGFLY---FETSAQTGEGINEMFQTFYMSIVDLCENGGKR- 192

  Fly   184 LQALEHKSFQVDTASSGAATNEEDASS 210
                       .||:|.|:..:|.|.:
  Rat   193 -----------PTANSSASYTKEQADT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 45/171 (26%)
Rab 10..172 CDD:206640 45/167 (27%)
Dnajc27NP_996727.2 Required for interaction with MAPK1. /evidence=ECO:0000250|UniProtKB:Q8CFP6 1..18 2/12 (17%)
RJL 17..184 CDD:133319 45/172 (26%)
DnaJ 217..264 CDD:99751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.