DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Rab12

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_037149.1 Gene:Rab12 / 25530 RGDID:3527 Length:243 Species:Rattus norvegicus


Alignment Length:181 Identity:65/181 - (35%)
Similarity:101/181 - (55%) Gaps:10/181 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KQKVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERV 72
            |.:||:.|..||||:||..||..:||....  |||:|:|...:...:..|:|:||:|||.|.||.
  Rat    41 KLQVIIIGSRGVGKTSLMERFTDDTFCEAC--KSTVGVDFKIKTVELRGKKIRLQIWDTAGQERF 103

  Fly    73 ASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDE 136
            .|:||:||:.|:|.|||:.:....:|..|.:.:..|..|| |:|::.:.|||.|.: .:.|:|.:
  Rat   104 NSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCE-TDREISRQ 167

  Fly   137 EVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQAL 187
            :.|.|.:|...:  ...:.|.:....|:|:|    .:||.....||.|..|
  Rat   168 QGEKFAQQITGM--RFCEASAKDNFNVDEIF----LKLVDDILKKMPLDVL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 59/166 (36%)
Rab 10..172 CDD:206640 58/162 (36%)
Rab12NP_037149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Rab12 42..243 CDD:206699 64/180 (36%)
Effector region. /evidence=ECO:0000250 70..78 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.