DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and ypt3

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001342809.1 Gene:ypt3 / 2542219 PomBaseID:SPAC18G6.03 Length:214 Species:Schizosaccharomyces pombe


Alignment Length:175 Identity:66/175 - (37%)
Similarity:104/175 - (59%) Gaps:11/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |.:|.||.|||||:|..||..|.|  :.:.|||:|::...|...::.|:||.|:|||.|.||..:
pombe    12 KTVLIGDSGVGKSNLLMRFTRNEF--NIESKSTIGVEFATRNIVLDNKKIKAQIWDTAGQERYRA 74

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138
            :||:||:.|.||::|:.:...:||.::.:.|.::..:|: |..|.:.|||:||.... .||.||.
pombe    75 ITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHADSNIVIMLVGNKTDLLHLR-AVSTEEA 138

  Fly   139 EAF-CEQCHSLISATYKTSCRSGAGVEEMFRDISRQL--VHANRS 180
            :|| .|...|.|    :||....:.|||.|:.:..::  :.:|||
pombe   139 QAFAAENNLSFI----ETSAMDASNVEEAFQTVLTEIFRIVSNRS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 63/169 (37%)
Rab 10..172 CDD:206640 63/163 (39%)
ypt3NP_001342809.1 Rab11_like 8..172 CDD:206660 63/166 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.