DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and ypt4

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_594796.1 Gene:ypt4 / 2542113 PomBaseID:SPAC1B3.11c Length:234 Species:Schizosaccharomyces pombe


Alignment Length:184 Identity:69/184 - (37%)
Similarity:104/184 - (56%) Gaps:14/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSV----NEKQIKLQLWDTGGME 70
            |::|.|..|.|||.|.:||..|.:  |.....|:|:|...|..||    .:|:||||:|||.|.|
pombe    11 KIVLAGPSGTGKSCLLQRFVKNQW--DDQVSHTVGIDFASRIISVGMGNQQKRIKLQIWDTAGQE 73

  Fly    71 RVASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAENA-KIFICGNKSDLDGREPEVS 134
            :..||..:||:.|.||:||:.:.|..||..||..|.||...|.:. .:.:.|:||||..:. :||
pombe    74 KFRSVARNYYRGAAGAVLVYDVTNKDSFEELSSWLSDIRAMAPSTICVVLAGSKSDLQNQR-QVS 137

  Fly   135 DEEVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALE 188
            .||...||.:.|  ||:.::||..:|:.|||.|..:...::    :::||..::
pombe   138 TEEAAEFCSEKH--ISSAHETSSYTGSNVEECFLSVVSTII----TRIELGEID 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 67/170 (39%)
Rab 10..172 CDD:206640 67/166 (40%)
ypt4NP_594796.1 RAB 10..178 CDD:197555 67/175 (38%)
Rab 10..173 CDD:206640 67/166 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.