DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and ypt7

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_596307.1 Gene:ypt7 / 2540763 PomBaseID:SPBC405.04c Length:205 Species:Schizosaccharomyces pombe


Alignment Length:209 Identity:59/209 - (28%)
Similarity:104/209 - (49%) Gaps:18/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |||:.|:.||||:|:..::....|  ..|.|:|:|.|.:.:|..|::|.:.||||||.|.||..|
pombe    10 KVIILGESGVGKTSIMNQYVNRKF--SKDYKATIGADFLTKEVLVDDKVVTLQLWDTAGQERFQS 72

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-----ENAKIFICGNKSDLDGREPEVS 134
            :..::|:.|:..:||:.::|:.||.:|.....:.:..|     |.....:.|||.|::.::..||
pombe    73 LGVAFYRGADCCVLVYDVNNSKSFETLDSWRDEFLIQASPSNPETFPFILLGNKVDVEEQKRMVS 137

  Fly   135 DEEVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASS 199
            ..:..|||:....:  ..::||.:....|:|.|..:         :|:.|:.::......|....
pombe   138 KSKALAFCQARGEI--PYFETSAKEAINVQEAFETV---------AKLALENMDSDDIAADFTDP 191

  Fly   200 GAATNEEDASSCGC 213
            .....|...:||.|
pombe   192 IHLDMESQKTSCYC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 52/170 (31%)
Rab 10..172 CDD:206640 52/166 (31%)
ypt7NP_596307.1 Rab7 9..181 CDD:206655 54/183 (30%)
RAB 9..178 CDD:197555 54/180 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.