Sequence 1: | NP_001261219.1 | Gene: | RabX6 / 38084 | FlyBaseID: | FBgn0035155 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006538910.1 | Gene: | Rab42 / 242681 | MGIID: | 2441753 | Length: | 219 | Species: | Mus musculus |
Alignment Length: | 223 | Identity: | 65/223 - (29%) |
---|---|---|---|
Similarity: | 107/223 - (47%) | Gaps: | 33/223 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KVILCGDYGVGKSSLFRRFATNT-FITDTDRKSTLGLDHIDREYSVNE-KQIKLQLWDTGGME-- 70
Fly 71 RVAS--VTSSYYKFAEGAILVFALDNAASF-HSLSQHLLDIVTYAENAKIF-ICGNKSDLDGREP 131
Fly 132 EVSDEEVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDT 196
Fly 197 ASSG-----------AATNEEDASSCGC 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX6 | NP_001261219.1 | RAB | 10..176 | CDD:197555 | 55/173 (32%) |
Rab | 10..172 | CDD:206640 | 55/169 (33%) | ||
Rab42 | XP_006538910.1 | P-loop_NTPase | 8..219 | CDD:393306 | 64/221 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
1 | 0.960 |