DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Rab42

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_006538910.1 Gene:Rab42 / 242681 MGIID:2441753 Length:219 Species:Mus musculus


Alignment Length:223 Identity:65/223 - (29%)
Similarity:107/223 - (47%) Gaps:33/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNT-FITDTDRKSTLGLDHIDREYSVNE-KQIKLQLWDTGGME-- 70
            ::.|.||.||||:||.|.:.... ...:.|.:.|:|::...|...:.. .::|||||||.|.|  
Mouse    11 RIALLGDAGVGKTSLLRCYVAGARGAAEPDPEPTVGVEFYSRALQLPAGLRVKLQLWDTAGQECF 75

  Fly    71 RVAS--VTSSYYKFAEGAILVFALDNAASF-HSLSQHLLDIVTYAENAKIF-ICGNKSDLDGREP 131
            |...  :|.|:|:...|.:|||.:.|..|| |..:.|...:.|...:..:| :.|:|.||:.|  
Mouse    76 RCGEKCITRSFYRNMVGVLLVFDVTNRESFEHIQAWHQEVVSTQGPDKVVFLLVGHKCDLNTR-- 138

  Fly   132 EVSDEEVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDT 196
            .||.:|.|   |...||.....:||.:|...|:..|..::        |.:| |||:....::|.
Mouse   139 CVSSQEAE---ELAASLGMGFMETSAKSNCNVDLAFDTVT--------SAIE-QALQQGDIKLDK 191

  Fly   197 ASSG-----------AATNEEDASSCGC 213
            ..:|           :::.::|:.:|.|
Mouse   192 DWAGVRLLHRSPNPRSSSRKQDSGTCQC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 55/173 (32%)
Rab 10..172 CDD:206640 55/169 (33%)
Rab42XP_006538910.1 P-loop_NTPase 8..219 CDD:393306 64/221 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.