DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Dnajc27

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_006515115.1 Gene:Dnajc27 / 217378 MGIID:2443036 Length:298 Species:Mus musculus


Alignment Length:247 Identity:60/247 - (24%)
Similarity:103/247 - (41%) Gaps:60/247 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IPKQ---------KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKL 61
            :||:         |||..|:..||||.:.:|:....|:  :...:|:|:|:...:..|.:::||:
Mouse     5 VPKRKEPAKSLRIKVISMGNAEVGKSCIIKRYCEKRFV--SKYLATIGIDYGVTKVQVRDREIKV 67

  Fly    62 QLWDTGGMERVASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVT------YAENAKIFIC 120
            .::|..|......|.:.:||..:|.|||:.:....||.:|...|.::..      ..:|....:|
Mouse    68 NIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMDNIVFVVC 132

  Fly   121 GNKSDLDGRE---PEVSDEEVEAFCE-------QC--HSLISAT-------------YKTSCRSG 160
            .||    ||:   |.|..:...:.|.       .|  |..|..:             ::||.::|
Mouse   133 ANK----GRDLTWPGVVGQGGFSLCPALTLFQIDCSKHRCIDESEGRLWAESKGFLYFETSAQTG 193

  Fly   161 AGVEEMFRDISRQLVH--ANRSKMELQALEHKSFQVDTASSGAATNEEDASS 210
            .|:.|||:.....:|.  .|..|.            .||||.|:..:|.|.:
Mouse   194 EGINEMFQTFYLSIVDLCENGGKR------------PTASSSASFTKEQADT 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 48/196 (24%)
Rab 10..172 CDD:206640 48/192 (25%)
Dnajc27XP_006515115.1 RJL 17..209 CDD:133319 48/197 (24%)
DnaJ 242..289 CDD:99751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.