DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and F11A5.3

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_507083.1 Gene:F11A5.3 / 184330 WormBaseID:WBGene00008671 Length:201 Species:Caenorhabditis elegans


Alignment Length:181 Identity:58/181 - (32%)
Similarity:99/181 - (54%) Gaps:13/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |.::.||.|||||:|..||....|  |....:|||::...::..:::.:::|::|||.|.|...|
 Worm     8 KYVIIGDGGVGKSNLLLRFTDELF--DPIHTTTLGVEFGYKDLQIDKYKVRLRVWDTCGQENFRS 70

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138
            :..:||:.|.||:||:.:....||..|.|.|.|:..:.. ...|.:.||||||.... :|:.||.
 Worm    71 IIRAYYRNALGALLVYDITCRKSFVHLEQWLSDLRQHGHPEMVIMLIGNKSDLKAVR-DVTTEEG 134

  Fly   139 EAFCEQCHSLISATY-KTSCRSGAGVEEMFRDISRQLVHANRSKMELQALE 188
            |||.::    ...|: :||.::...||:.|.:.:.::.    .|::|..:|
 Worm   135 EAFAKK----NGLTFMETSAKANKHVEKAFVNTAHEIY----KKLKLGVIE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 55/167 (33%)
Rab 10..172 CDD:206640 55/163 (34%)
F11A5.3NP_507083.1 P-loop_NTPase 5..170 CDD:304359 55/172 (32%)
RAB 7..170 CDD:197555 55/172 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.