Sequence 1: | NP_001261219.1 | Gene: | RabX6 / 38084 | FlyBaseID: | FBgn0035155 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001359915.1 | Gene: | rsef-1 / 180593 | WormBaseID: | WBGene00016344 | Length: | 634 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 61/206 - (29%) |
---|---|---|---|
Similarity: | 94/206 - (45%) | Gaps: | 21/206 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
Fly 75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAENA-KIFICGNKSDLDGREP-EVSDEE 137
Fly 138 VEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAA 202
Fly 203 TNEEDASSCGC 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX6 | NP_001261219.1 | RAB | 10..176 | CDD:197555 | 50/167 (30%) |
Rab | 10..172 | CDD:206640 | 49/163 (30%) | ||
rsef-1 | NP_001359915.1 | EF-hand_7 | 3..63 | CDD:372618 | |
Smc | <155..>362 | CDD:224117 | |||
Rab | 440..600 | CDD:206640 | 49/163 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |