DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and rab-19

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001370091.1 Gene:rab-19 / 178301 WormBaseID:WBGene00004278 Length:210 Species:Caenorhabditis elegans


Alignment Length:211 Identity:63/211 - (29%)
Similarity:104/211 - (49%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRK-STLGLDHIDREYSVNEKQIKLQLWDTGGMERVA 73
            |::|.||.||||:.:.:||...||:   ||: :|:|:|...:...|:.|::|||:|||||.||..
 Worm    12 KIVLVGDMGVGKTCVVQRFRNGTFV---DRQGTTIGVDFTMKTLVVDGKRVKLQIWDTGGQERFR 73

  Fly    74 SVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTY-AENAKIFICGNKSDLDGREPEVSDEE 137
            ::|.|||:.|.|.:|.:.:....||.||.:.:.|:..: |.|....:.|.|.||:.:. .:..||
 Worm    74 TITQSYYRSANGIVLCYDITCKQSFGSLQRWIDDVSKFAAPNVVKLLIGTKCDLEDQR-AIEAEE 137

  Fly   138 VEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAA 202
            .| ..::.:.:. |..:||.:....|:..|              :||..:..:.:.......|  
 Worm   138 AE-MLQRANGMF-AMLETSAKGNVNVDNAF--------------LELATILKRQYDQGVVEQG-- 184

  Fly   203 TNEEDASSCGCXQLGN 218
                   |.|..|||:
 Worm   185 -------SSGTFQLGS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 55/167 (33%)
Rab 10..172 CDD:206640 55/163 (34%)
rab-19NP_001370091.1 Rab19 8..172 CDD:133267 57/179 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.