DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and kbrl-1

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_492076.1 Gene:kbrl-1 / 172487 WormBaseID:WBGene00009919 Length:364 Species:Caenorhabditis elegans


Alignment Length:98 Identity:24/98 - (24%)
Similarity:47/98 - (47%) Gaps:14/98 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSV------NEKQIKLQLWDTGG 68
            :|::.|...|||:::.|:.|....:|:...:.|     |:..|.|      ..::| |.|.||.|
 Worm   171 RVVVVGGKKVGKTAILRQVACVEDVTNKPYEPT-----IEDTYQVLLEEPDKAREI-LILHDTAG 229

  Fly    69 MERVASV--TSSYYKFAEGAILVFALDNAASFH 99
            :.....:  ..:|.:.|:..:||::..:..||:
 Worm   230 VSNYGPIELKKAYVQAADAFVLVYSSADYESFN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 24/98 (24%)
Rab 10..172 CDD:206640 24/98 (24%)
kbrl-1NP_492076.1 small_GTP 179..328 CDD:272973 22/90 (24%)
P-loop_NTPase 183..322 CDD:304359 19/86 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.