DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and unc-108

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001343725.1 Gene:unc-108 / 171956 WormBaseID:WBGene00006833 Length:223 Species:Caenorhabditis elegans


Alignment Length:214 Identity:73/214 - (34%)
Similarity:112/214 - (52%) Gaps:16/214 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |.|:.||.|||||.|..:|....|....|  .|:|::...|..:::.||||||:|||.|.|...|
 Worm    17 KYIIIGDTGVGKSCLLLQFTDKRFQPVHD--LTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRS 79

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138
            :|.|||:.|.||:||:.:....:|:.|:..|.|...:: .|..|.:.||||||:.|. ||..||.
 Worm    80 ITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKSDLEARR-EVKREEG 143

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAAT 203
            |||..: |.|:  ..:||.::.|.|||.|.|.::::         .:.::...|.::..::|...
 Worm   144 EAFARE-HGLV--FMETSAKTAANVEEAFIDTAKEI---------YRKIQEGVFDINNEANGIKL 196

  Fly   204 NEEDASSCGCXQLGNIEFG 222
            ..:.:.|... ..||...|
 Worm   197 GPQHSPSSPNSPGGNATGG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 67/166 (40%)
Rab 10..172 CDD:206640 67/162 (41%)
unc-108NP_001343725.1 Ras 10..202 CDD:331851 69/199 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.