DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and rab2a

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_958862.1 Gene:rab2a / 140617 ZFINID:ZDB-GENE-011212-2 Length:212 Species:Danio rerio


Alignment Length:216 Identity:78/216 - (36%)
Similarity:112/216 - (51%) Gaps:23/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |.|:.||.|||||.|..:|....|....|  .|:|::...|..:::.||||||:|||.|.|...|
Zfish     8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHD--LTIGVEFGARMITIDGKQIKLQIWDTAGQESFRS 70

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138
            :|.|||:.|.||:||:.:....:|:.|:..|.|...:: .|..|.:.||||||:.|. ||..||.
Zfish    71 ITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRR-EVKKEEG 134

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSG--- 200
            |||..: |.||  ..:||.::.:.|||.|         .|.:|...:.::...|.::..::|   
Zfish   135 EAFARE-HGLI--FMETSAKTASNVEEAF---------INTAKEIYEKIQEGVFDINNEANGIKI 187

  Fly   201 ----AATNEEDASSCGCXQLG 217
                ||||.....|.|. |.|
Zfish   188 GPQHAATNSTMGGSQGGQQAG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 66/166 (40%)
Rab 10..172 CDD:206640 66/162 (41%)
rab2aNP_958862.1 PLN03108 1..188 CDD:178655 70/194 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.