DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and AgaP_AGAP001874

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_003435963.1 Gene:AgaP_AGAP001874 / 1281247 VectorBaseID:AGAP001874 Length:184 Species:Anopheles gambiae


Alignment Length:173 Identity:45/173 - (26%)
Similarity:84/173 - (48%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |:::.|..|||||:|..:|....|:...|  .|:. |...::..|:.:|..|::.||.|.|:..:
Mosquito     5 KIVVLGSGGVGKSALTVQFVQGIFVEKYD--PTIE-DSYRKQVEVDGQQCMLEILDTAGTEQFTA 66

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDI--VTYAENAKIFICGNKSDLDGREPEVSDEE 137
            :...|.|..:|.:||:::...::|:.|......|  |...::..:.:.|||.||:       ||.
Mosquito    67 MRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLE-------DER 124

  Fly   138 V------EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQL 174
            |      .:...|.:   .|..:||.::...|.::|.|:.:|:
Mosquito   125 VVGKDLGRSLAAQFN---CAFMETSAKAKINVNDIFYDLVQQI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 45/173 (26%)
Rab 10..172 CDD:206640 44/169 (26%)
AgaP_AGAP001874XP_003435963.1 small_GTPase 2..167 CDD:197466 45/173 (26%)
Rap1 3..166 CDD:133375 45/173 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.