DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and AgaP_AGAP005159

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_314049.4 Gene:AgaP_AGAP005159 / 1274841 VectorBaseID:AGAP005159 Length:257 Species:Anopheles gambiae


Alignment Length:201 Identity:49/201 - (24%)
Similarity:97/201 - (48%) Gaps:28/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |:::.||.|||||::..:|.:::|:...|  .|:. |...::..::.:...|.:.||.|.....:
Mosquito    50 KIVILGDGGVGKSAVTLQFVSHSFLDYHD--PTIE-DSYQQQAVIDGEAALLDILDTAGQVEFTA 111

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQH--LLDIVTYAENAKIFICGNKSDLDGREPEVSDEE 137
            :...|.:..||.|:.:::.:..||...|::  |:..|...|:..:.:..||.||..:. :|:.||
Mosquito   112 MRDQYMRCGEGFIICYSVTDRHSFQEASEYRKLIARVRLTEDIPLVLVANKLDLQSQR-KVTTEE 175

  Fly   138 VEAFCEQ--CHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSG 200
            .:...:|  |     ..|:||......::|.|..:.|::    |.|.|.:||           :|
Mosquito   176 GKTLAKQFGC-----PFYETSAALRHYIDEAFFSLVREI----RRKEEQRAL-----------NG 220

  Fly   201 AATNEE 206
            .:::|:
Mosquito   221 GSSSEK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 42/169 (25%)
Rab 10..172 CDD:206640 41/165 (25%)
AgaP_AGAP005159XP_314049.4 Rit_Rin_Ric 47..218 CDD:206712 45/180 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.