DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and AgaP_AGAP002991

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_311898.4 Gene:AgaP_AGAP002991 / 1272967 VectorBaseID:AGAP002991 Length:393 Species:Anopheles gambiae


Alignment Length:196 Identity:55/196 - (28%)
Similarity:88/196 - (44%) Gaps:27/196 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KQKVILCGDYGVGKSSLFRRFATNTFITDTDR-KSTLGLDHIDREYSVNEKQIKLQLWDTGGMER 71
            |:||:|.|..|.||:|:......|....||.| .:|:.::|....:..|   :.|.|||.||.|.
Mosquito     2 KKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGN---LVLNLWDCGGQES 63

  Fly    72 -----VASVTSSYYKFAEGAILVFALDNA---ASFHSLSQHLLDIVTYAENAKIFICGNKSDLDG 128
                 .||...:.::..|..|.||.:::.   ...|.....|..::..:.|||||...:|.||..
Mosquito    64 FMEQYFASQKDNIFRNVEVLIYVFDVESRELDKDMHYYQSCLEALLVNSPNAKIFCLVHKMDLVA 128

  Fly   129 REP-EVSDEEVEAFCEQCHSLISAT-YKTSCRSGAGVEEMFR---DISRQLVHANRSKMELQALE 188
            .|. ::..:|.|...::|...:..| ::||...    |.::|   .|..||:      ..::|||
Mosquito   129 EEQRDIIFKEREEDLKRCSRPLECTAFRTSIWD----ETLYRAWSSIVYQLI------PNVKALE 183

  Fly   189 H 189
            |
Mosquito   184 H 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 50/179 (28%)
Rab 10..172 CDD:206640 48/175 (27%)
AgaP_AGAP002991XP_311898.4 RagA_like 4..287 CDD:206744 54/194 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.