DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and AgaP_AGAP009325

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_309994.3 Gene:AgaP_AGAP009325 / 1271237 VectorBaseID:AGAP009325 Length:209 Species:Anopheles gambiae


Alignment Length:215 Identity:145/215 - (67%)
Similarity:178/215 - (82%) Gaps:8/215 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATMRIPKQKVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWD 65
            ||::|||:||:||||:|||||||:|||||||.|:|..||||||||||..|.::|.:|:|||||||
Mosquito     1 MASVRIPEQKIILCGEYGVGKSSIFRRFATNNFVTAADRKSTLGLDHYGRTFTVGDKEIKLQLWD 65

  Fly    66 TGGMERVASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAENAKIFICGNKSDLD--G 128
            |||||||||||||||||||.|||||||||.:|||:||||:||:||||||||||:.|||.||:  .
Mosquito    66 TGGMERVASVTSSYYKFAEAAILVFALDNESSFHALSQHMLDVVTYAENAKIFLVGNKVDLESSS 130

  Fly   129 REPEVSDEEVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQ 193
            .:|.|:|.::|:|||||||||||||||||::|.|:|||||||:..||.:|||::||||||...|:
Mosquito   131 TDPPVTDADMESFCEQCHSLISATYKTSCKTGDGLEEMFRDIAGTLVESNRSRLELQALESHGFK 195

  Fly   194 VDTASSGAATNEEDASSCGC 213
            :.      ..:|.:..||.|
Mosquito   196 IH------PPDEVNDPSCLC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 124/167 (74%)
Rab 10..172 CDD:206640 123/163 (75%)
AgaP_AGAP009325XP_309994.3 RAB 10..173 CDD:197555 122/162 (75%)
Rab 10..173 CDD:206640 122/162 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 260 1.000 Domainoid score I4579
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H64623
Inparanoid 1 1.050 295 1.000 Inparanoid score I5122
OMA 1 1.010 - - QHG50091
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016839
OrthoInspector 1 1.000 - - otm51137
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X13650
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.