DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and AgaP_AGAP011306

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_309343.4 Gene:AgaP_AGAP011306 / 1270628 VectorBaseID:AGAP011306 Length:278 Species:Anopheles gambiae


Alignment Length:213 Identity:45/213 - (21%)
Similarity:91/213 - (42%) Gaps:18/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KQKVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERV 72
            :.|:::.|...||||||..:|..::|  ....|.|:...| ...:||....:.|.:.||.|....
Mosquito    44 RHKIVMMGAAKVGKSSLITQFLYSSF--SPKYKRTVEEMH-HGHFSVGGVNLTLDILDTSGSYEF 105

  Fly    73 ASVTSSYYKFAEGAILVFALDNAASFHSLS--QHLLDIVTYAENAKIFICGNKSDLDGREPEVSD 135
            .::.:.....|:..|||:.:.::.:|..:.  :..:..:.......|.:.|||:||..     .|
Mosquito   106 PAMRALSISSADAFILVYDVTDSITFEEVKAIREQIHEIKSTTAVPIVVVGNKTDLSD-----ED 165

  Fly   136 EEV-EAFCEQCHSLISATY-----KTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSF-- 192
            |:: :...:...|:::..:     :.|.:....|.::|:::..|..........|:....:|.  
Mosquito   166 EDLRQVPRDTTESMVTVDWENGFVEASAKLNRNVTQIFKELLVQAKITYNLSPALRRRRRQSLPQ 230

  Fly   193 QVDTASSGAATNEEDASS 210
            |..|.|:||....:.:.|
Mosquito   231 QASTGSTGAPATPQASPS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 37/173 (21%)
Rab 10..172 CDD:206640 36/169 (21%)
AgaP_AGAP011306XP_309343.4 small_GTPase 45..212 CDD:197466 37/174 (21%)
P-loop_NTPase 46..278 CDD:304359 45/211 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.