Sequence 1: | NP_001261219.1 | Gene: | RabX6 / 38084 | FlyBaseID: | FBgn0035155 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031753456.1 | Gene: | rerg / 100134997 | XenbaseID: | XB-GENE-489597 | Length: | 228 | Species: | Xenopus tropicalis |
Alignment Length: | 205 | Identity: | 53/205 - (25%) |
---|---|---|---|
Similarity: | 88/205 - (42%) | Gaps: | 43/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KVILCGDYGVGKS-----------------------------SLFRRFATNTFITDTDRKSTLGL 45
Fly 46 DHIDREYSVNEKQIKLQLWDTGGMERVASVTSSYYKFAEGAILVFALDNAASFHSL--SQHLLDI 108
Fly 109 VTYAENAKIFICGNKSDLDGREPEVSDEEVEAFCEQCHSLISATYKTSCRSGAG-VEEMFRDISR 172
Fly 173 QLVHANRSKM 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX6 | NP_001261219.1 | RAB | 10..176 | CDD:197555 | 50/197 (25%) |
Rab | 10..172 | CDD:206640 | 49/193 (25%) | ||
rerg | XP_031753456.1 | RERG_RasL11_like | 8..198 | CDD:206713 | 50/200 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |