DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and rerg

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_031753456.1 Gene:rerg / 100134997 XenbaseID:XB-GENE-489597 Length:228 Species:Xenopus tropicalis


Alignment Length:205 Identity:53/205 - (25%)
Similarity:88/205 - (42%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKS-----------------------------SLFRRFATNTFITDTDRKSTLGL 45
            |:.:.|..|||||                             ||..||.|..||.:.|.......
 Frog     8 KIAILGRAGVGKSGSYLLLGHEWVIKKTAVKCTAHLHHQASLSLVVRFLTKRFIWEYDPTLESTY 72

  Fly    46 DHIDREYSVNEKQIKLQLWDTGGMERVASVTSSYYKFAEGAILVFALDNAASFHSL--SQHLLDI 108
            .|   :.::::..:.::|.||.|.|.... ...:.::|:|..:|:.:.:..||..:  .::|||.
 Frog    73 RH---QATIDDDLVTMELLDTAGQEDTIQ-REGHVRWADGFAIVYDITDKGSFDEVLPFKNLLDE 133

  Fly   109 VTYAENAKIFICGNKSDLDGREPEVSDEEVEAFCEQCHSLISATYKTSCRSGAG-VEEMFRDISR 172
            :...:|....:.|||:|||... :||.||.|....:   |..|.|:.|..:|.| :.|.|.::.|
 Frog   134 IKKPKNVTFILVGNKADLDHCR-QVSTEEGEKLATE---LACAFYECSACTGEGNISEAFYELCR 194

  Fly   173 QLVHANRSKM 182
            ::   .|.||
 Frog   195 EV---RRRKM 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 50/197 (25%)
Rab 10..172 CDD:206640 49/193 (25%)
rergXP_031753456.1 RERG_RasL11_like 8..198 CDD:206713 50/200 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.