DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and rab3b

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001093746.1 Gene:rab3b / 100101786 XenbaseID:XB-GENE-483427 Length:217 Species:Xenopus tropicalis


Alignment Length:210 Identity:59/210 - (28%)
Similarity:109/210 - (51%) Gaps:22/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |:::.|:..|||:|...|:|.:||.:..  .||:|:|...:....|:|::|||:|||.|.||..:
 Frog    24 KLLIIGNSSVGKTSFLFRYADDTFTSAF--VSTVGIDFKVKTVYRNDKRVKLQIWDTAGQERYRT 86

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138
            :|::||:.|.|.||::.:.:.:|::::......|.||: :||::.:.|||.|:: .|..::.|:.
 Frog    87 ITTAYYRGAMGFILMYDITSESSYNAVQDWATQIKTYSWDNAQVILVGNKCDME-EERVIAPEKG 150

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAAT 203
            :...:|   |....::.|.:....|:::|    .:||.....||.      :|...|....|...
 Frog   151 KHLADQ---LGFEFFEASAKENIQVKQVF----ERLVDIICDKMS------ESLDTDQPPGGKNL 202

  Fly   204 NEEDAS-----SCGC 213
            ...|.:     .|.|
 Frog   203 RFTDTAPPIHQKCSC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 50/166 (30%)
Rab 10..172 CDD:206640 49/162 (30%)
rab3bNP_001093746.1 Rab3 22..186 CDD:206657 51/171 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.