DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hiro and AT5G22960

DIOPT Version :9

Sequence 1:NP_612051.1 Gene:hiro / 38083 FlyBaseID:FBgn0035154 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_197687.1 Gene:AT5G22960 / 832360 AraportID:AT5G22960 Length:190 Species:Arabidopsis thaliana


Alignment Length:206 Identity:51/206 - (24%)
Similarity:92/206 - (44%) Gaps:35/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLALLGFAGLASVDARKGYG-PGDQDWG-----FVDVRT-GAHMFYWLYYTTANVSSYTERPLAI 66
            ||.:..|:.|:|.     :| |..:|.|     |...|: .|.:|::.:.:..|.|.    |:.|
plant    11 LLIVCIFSQLSST-----FGDPSVKDLGQHAGYFSLPRSKSARLFHFFFQSRNNSSD----PVVI 66

  Fly    67 WLQGGPGASSTGYGNFEELGPLKLDGSYRDWTWVKDMNVMFIDNPVGSGFSYVDGSSYYTTNNKQ 131
            ||.||||.||:               :.|..:::|..|::::|.|:.:||||.:.|:....:...
plant    67 WLSGGPGCSSS---------------NQRYISYLKISNLIYVDQPIRTGFSYANDSTDLRHDEDS 116

  Fly   132 IALDLVELMKGFYTNHPEFKTVPLHIFCESYGGKMAPEFALELDYAIKRGEIESNFVSVALGDPW 196
            ::.||.:.::.|:..||.......:|..|||.|...|..|..    :..|..:...:.:.|....
plant   117 VSNDLYDFLQAFFKEHPNLAKDDFYITGESYAGHYIPALASR----VHNGNEKKEGIVINLKVTD 177

  Fly   197 TSPIDSVLSWA 207
            .|.:.:..:|:
plant   178 ISLVTATATWS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hiroNP_612051.1 Peptidase_S10 29..444 CDD:298660 45/185 (24%)
AT5G22960NP_197687.1 Peptidase_S10 31..>174 CDD:385311 41/165 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D625787at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.