powered by:
Protein Alignment hiro and Y67A10A.11
DIOPT Version :9
Sequence 1: | NP_612051.1 |
Gene: | hiro / 38083 |
FlyBaseID: | FBgn0035154 |
Length: | 446 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001076741.1 |
Gene: | Y67A10A.11 / 4927036 |
WormBaseID: | WBGene00044906 |
Length: | 292 |
Species: | Caenorhabditis elegans |
Alignment Length: | 103 |
Identity: | 26/103 - (25%) |
Similarity: | 32/103 - (31%) |
Gaps: | 43/103 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 330 SGTTFTKLMGDFMKPAVDVVGELLNNTTVKVGVFSGGLDLICATPGAVNWIEAMEWSAKPSYQVS 394
|.|..:..||:. |.:.|..:| :||.|. |.||
Worm 51 SRTCLSTQMGNC--PCIGVTTKL----------------MICNTQ-ACNW--------------- 81
Fly 395 PRVGITVDRVLEGYEKTYGNFSMFWVNRAGHMVP-ADN 431
|||..|.:....|...|..| || |..| .||
Worm 82 PRVNATYENCCTGTLTTIAN----WV----HCAPLPDN 111
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
hiro | NP_612051.1 |
Peptidase_S10 |
29..444 |
CDD:298660 |
26/103 (25%) |
Y67A10A.11 | NP_001076741.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2939 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.