DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hiro and Y67A10A.11

DIOPT Version :9

Sequence 1:NP_612051.1 Gene:hiro / 38083 FlyBaseID:FBgn0035154 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001076741.1 Gene:Y67A10A.11 / 4927036 WormBaseID:WBGene00044906 Length:292 Species:Caenorhabditis elegans


Alignment Length:103 Identity:26/103 - (25%)
Similarity:32/103 - (31%) Gaps:43/103 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 SGTTFTKLMGDFMKPAVDVVGELLNNTTVKVGVFSGGLDLICATPGAVNWIEAMEWSAKPSYQVS 394
            |.|..:..||:.  |.:.|..:|                :||.|. |.||               
 Worm    51 SRTCLSTQMGNC--PCIGVTTKL----------------MICNTQ-ACNW--------------- 81

  Fly   395 PRVGITVDRVLEGYEKTYGNFSMFWVNRAGHMVP-ADN 431
            |||..|.:....|...|..|    ||    |..| .||
 Worm    82 PRVNATYENCCTGTLTTIAN----WV----HCAPLPDN 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hiroNP_612051.1 Peptidase_S10 29..444 CDD:298660 26/103 (25%)
Y67A10A.11NP_001076741.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.