Sequence 1: | NP_612051.1 | Gene: | hiro / 38083 | FlyBaseID: | FBgn0035154 | Length: | 446 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505684.2 | Gene: | F22E12.1 / 179460 | WormBaseID: | WBGene00009058 | Length: | 763 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 42/204 - (20%) |
---|---|---|---|
Similarity: | 68/204 - (33%) | Gaps: | 61/204 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 WLQGGPGASSTGY---------GNFEELGPLKLDGSYRDWTWVKDMN-------VMFIDNPVGSG 115
Fly 116 FSYVD---------GSSYYTT-----------NNKQIALDLVELMKG-FYTNHPEFKTVPLHIFC 159
Fly 160 ESYGGKMAPEFALELD-YAIKRGEIESNFVSVALGDPWTSPIDSVLSWAPFLLQLGIVDQDGHDK 223
Fly 224 IEASALKTK 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hiro | NP_612051.1 | Peptidase_S10 | 29..444 | CDD:298660 | 42/204 (21%) |
F22E12.1 | NP_505684.2 | KU | 25..76 | CDD:238057 | |
KU | 85..138 | CDD:238057 | 5/21 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160165187 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |