DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hiro and F22E12.1

DIOPT Version :9

Sequence 1:NP_612051.1 Gene:hiro / 38083 FlyBaseID:FBgn0035154 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:204 Identity:42/204 - (20%)
Similarity:68/204 - (33%) Gaps:61/204 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WLQGGPGASSTGY---------GNFEELGPLKLDGSYRDWTWVKDMN-------VMFIDNPVGSG 115
            |..|..|.|:..|         |.:.|.|| .:|..|    |.:.||       :...:||..|.
 Worm   116 WWSGCGGNSNIYYSYNHCMLICGEYAEHGP-GIDEKY----WGRQMNRSMSAESLHVFNNPTESF 175

  Fly   116 FSYVD---------GSSYYTT-----------NNKQIALDLVELMKG-FYTNHPEFKTVPLHIFC 159
            ..|.:         .:|||.:           :||.:.:::.....| .|.:.....|||:.   
 Worm   176 HQYSEEPYPVQVPLENSYYDSHPRRYGNSDNWDNKLMTINISHRDDGPSYFHAAPAVTVPMF--- 237

  Fly   160 ESYGGKMAPEFALELD-YAIKRGEIESNFVSVALGDPWTSPIDSVLSWAPFLLQLGIVDQDGHDK 223
                .:.|..|..:.| ..|.|.:.|...:.|         :|..::|.  :.:.....|:|..|
 Worm   238 ----SRAAQSFKTQADGLTIHRYDSEPRPMQV---------LDQDVNWQ--IQEQASAQQNGFMK 287

  Fly   224 IEASALKTK 232
            ......|.|
 Worm   288 RRFKMQKKK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hiroNP_612051.1 Peptidase_S10 29..444 CDD:298660 42/204 (21%)
F22E12.1NP_505684.2 KU 25..76 CDD:238057
KU 85..138 CDD:238057 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.