DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hiro and K10C2.12

DIOPT Version :9

Sequence 1:NP_612051.1 Gene:hiro / 38083 FlyBaseID:FBgn0035154 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001257042.1 Gene:K10C2.12 / 13221052 WormBaseID:WBGene00206386 Length:88 Species:Caenorhabditis elegans


Alignment Length:63 Identity:14/63 - (22%)
Similarity:25/63 - (39%) Gaps:9/63 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 ASALKTKDYVDREKWTQATLQWSSTQSVVLRESKGVDFYNVETPTLGDQYRLMSRAAMTPEEV 288
            |:..:.|..::......:.:||....:..|.:||.:..|.:.     |.|.:.|    ||..|
 Worm    27 ATVAEAKSKIEEMTTVPSQIQWIVFGTTHLEDSKPLREYGIR-----DGYTIYS----TPTYV 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hiroNP_612051.1 Peptidase_S10 29..444 CDD:298660 14/63 (22%)
K10C2.12NP_001257042.1 Ubl_ubiquitin_like 16..74 CDD:340559 10/51 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.