powered by:
Protein Alignment hiro and K10C2.12
DIOPT Version :9
Sequence 1: | NP_612051.1 |
Gene: | hiro / 38083 |
FlyBaseID: | FBgn0035154 |
Length: | 446 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257042.1 |
Gene: | K10C2.12 / 13221052 |
WormBaseID: | WBGene00206386 |
Length: | 88 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 14/63 - (22%) |
Similarity: | 25/63 - (39%) |
Gaps: | 9/63 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 226 ASALKTKDYVDREKWTQATLQWSSTQSVVLRESKGVDFYNVETPTLGDQYRLMSRAAMTPEEV 288
|:..:.|..::......:.:||....:..|.:||.:..|.:. |.|.:.| ||..|
Worm 27 ATVAEAKSKIEEMTTVPSQIQWIVFGTTHLEDSKPLREYGIR-----DGYTIYS----TPTYV 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2939 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.