DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ebd1 and CG13895

DIOPT Version :9

Sequence 1:NP_612050.1 Gene:ebd1 / 38082 FlyBaseID:FBgn0035153 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001261220.1 Gene:CG13895 / 38087 FlyBaseID:FBgn0035158 Length:506 Species:Drosophila melanogaster


Alignment Length:570 Identity:144/570 - (25%)
Similarity:227/570 - (39%) Gaps:171/570 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 KNVLALNEKVAALREYDRLPVYKHVGRLFNCSPDQIKRIVQQRAEILNAWDQRTRRSQDA-KTME 155
            :|||.|.|:|||:|:||.:|:|..:.|.||||.:|||.||..|..||.......|.||.| |..|
  Fly    26 RNVLTLEERVAAIRQYDIVPMYSKIARNFNCSWEQIKSIVSNREAILEFHKATNRLSQPANKDAE 90

  Fly   156 TKTVRVSMLGKAVYDWIRRMMYYKDFSISDGLIQKMALQFKSSMNLAHFFPHQEWCDKFRRTYSI 220
            .:..:::.||..:|::|:|..:|....:::.:|:..|::|:..|.|..|.|::.|.:.|:..|:|
  Fly    91 LRRRKLNFLGHCLYEYIQRAQFYLHSDVNEEMIRNRAIEFRDLMQLDGFVPNKPWINHFKAAYNI 155

  Fly   221 QHSDTRLLKIGYTQGYSVQIKDIVK-----DVMSESMPESGPRNGEEDDEEVSLGSPVSSHP--- 277
            ..|: |.:.|......|:.::||:.     ..||.|:....|        |.:|.|  |..|   
  Fly   156 TLSN-RQITIVRRPPRSMDLRDIMSYCGRHTSMSCSLAPRSP--------EPALTS--SDRPLYR 209

  Fly   278 -------RSYVEDEDDEV------------------------------DVDG---GGISGEDDLE 302
                   .|..:...|||                              |:|.   ..||..|.|:
  Fly   210 TKTLVTTSSQNQATSDEVHLRRKRKLAFLEKCVYEYIQRSQLVRQGRLDLDNLRFVAISLRDILK 274

  Fly   303 EE---PD---VKPSLSELNFARALKPLPPLVRLPLQANTPPGTTQKVLLATPIVPTQAGGQPMTM 361
            .:   ||   :|...|..||...:                                   |..:|.
  Fly   275 IDSFFPDKVWLKHFKSRYNFNFTV-----------------------------------GVQVTN 304

  Fly   362 TIIPLATLAQSIT--------KIPAPQQQDKGPVVPPPKLEIKQEKEIKVEPKDPEELLAKQPEA 418
            ..:||:...:.|.        ||....::.:..:....|.|:.|..:  |||| |||.       
  Fly   305 RRLPLSLDLRDIVSYCGRNEHKITLDHKKSQEELSQSDKPEVDQCPQ--VEPK-PEEF------- 359

  Fly   419 ELQENDDRAQREKDLEIPPTVHIKVEPEAELESELDQDPADLDEDANNGRSSVTSLAEVLAANVE 483
            |.:|:||...    :|:||.: |:::.:.:.:.| ..|..||.|.|...:|.            |
  Fly   360 EHEEDDDCVA----IEVPPEL-IEIKDDEDNDDE-HNDNEDLPERATKRKSD------------E 406

  Fly   484 DEMEYIEQMRQRKVSSPAAVENSLNPRQGTKRRYESAQDDN-----NNGGSGQESGSS------V 537
            :.......::.:|:       .|||         ||..:|.     |:.|...|:...      |
  Fly   407 NGGPIPCGLKIQKI-------QSLN---------ESLPEDTELLPANSPGHYSETSDEAHLPRCV 455

  Fly   538 ISCADARKYLKLLEEFALYKENYRLIELITRADEVM-------REMDDNV 580
            .|..||.:.||.||||.|.:||||.|.|:|:.:::.       .|||.::
  Fly   456 ESYKDALRLLKPLEEFVLMEENYRAIGLLTQLEKIFESAAKKSEEMDKSL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ebd1NP_612050.1 HTH 90..138 CDD:304362 24/45 (53%)
CENPB 158..224 CDD:197828 17/65 (26%)
CG13895NP_001261220.1 HTH 24..74 CDD:304362 26/47 (55%)
CENPB 93..159 CDD:197828 17/65 (26%)
CENPB 232..298 CDD:197828 12/65 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F66R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014353
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.