DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ebd1 and CG13894

DIOPT Version :9

Sequence 1:NP_612050.1 Gene:ebd1 / 38082 FlyBaseID:FBgn0035153 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster


Alignment Length:521 Identity:111/521 - (21%)
Similarity:187/521 - (35%) Gaps:151/521 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PDQIKRIVQQRAEILNAWDQRTRRSQDAKTMETKTVRVSMLGKAVYDWIRRMMYYKDF--SISDG 186
            |..::.:.||      |..:...||:          :.:.:...||:|:.|.......  ||:.|
  Fly    85 PSNLEAVEQQ------AMVEEIERSR----------KCAYINAVVYEWLVRANINPQLRGSITHG 133

  Fly   187 LIQKMALQFKSSMNLAHFFPHQEWCDKFRRTYSIQHSDTRLLKIGYTQ----GYSVQIKDIVKDV 247
            :|:..|...:..:....|.....|.::||.|    |......|:...|    |.|:.|.|||:|:
  Fly   134 MIKDKAENARQVIGSTSFIADNRWLNRFRET----HLQGFAQKLASNQLKPLGSSLWIPDIVQDL 194

  Fly   248 MSESMPESGPRNGEEDDEEVSLGSPVSSHPRSYV---------EDEDDEVDVDGGGISGEDDLEE 303
            .....|.|..|..:           :...|..|:         |::||.:||.      |...:|
  Fly   195 AHLFPPASAERVAK-----------LEEMPEQYMTYMQQYGEYEEDDDSMDVK------EQSYQE 242

  Fly   304 EPDVKPSLSELNFARALK-----------PLPPLVRLPLQANTPPGTTQKVLLATPIVPTQAGG- 356
            :...:    :.:||...:           |.||.          ||        .|..||...| 
  Fly   243 QQQQQ----QQHFALQQQHMQQQQHQMGHPWPPF----------PG--------HPGHPTPHPGF 285

  Fly   357 ------------QPMTMTIIPLATLAQSITKIPAPQQQDKGPVVP---PPKLEIKQEKEIKVEPK 406
                        |.|...:.....:.|....:| ||::...|.:|   ||:         :..|.
  Fly   286 ASFNDFYFERHQQQMQQQLQQQQQMQQFPPTMP-PQREPFQPQLPPNVPPQ---------RASPF 340

  Fly   407 DPEELLAKQPEAELQENDDRAQREKDLEIPPTVHIKVEPEAE--LESELDQDPADLDEDANN--G 467
            .|.: |||:|:.|..::|:..:....:..||      .|.||  |.|:..:..:..:::.||  |
  Fly   341 QPVQ-LAKRPKMESPDDDEVQEINSAVNSPP------YPLAESTLTSKHSRSSSPNEQNNNNSGG 398

  Fly   468 RSSVTS-------------LAEVLAANVEDEMEYIEQMRQRKVSSPAAVENSLNPRQGTKRRYES 519
            |.|.:|             ....|::..:|..........:..|:||:.:...|.        .|
  Fly   399 RDSASSKENAPKGGGTSGKSTPALSSKGKDSPAPARAASTKPASAPASPKKIPNG--------SS 455

  Fly   520 AQDDNNNGGSGQESGSSVISCA--------DARKYLKLLEEFALYKENYRLIELITRADEVMREM 576
            :.....||.:..:.......|.        .|.:|||.||:|.|:|||:|.|.|:::.:.|:|:.
  Fly   456 SSGSQTNGHTSPDPEDKKALCMLKELESYHQALEYLKPLEDFVLFKENFRAIGLLSQLELVLRKG 520

  Fly   577 D 577
            |
  Fly   521 D 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ebd1NP_612050.1 HTH 90..138 CDD:304362 3/13 (23%)
CENPB 158..224 CDD:197828 15/67 (22%)
CG13894NP_612054.1 THAP 6..82 CDD:214951
CENPB 104..165 CDD:197828 14/74 (19%)
NST1 382..>468 CDD:290656 15/93 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F66R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014353
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.