DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3386 and CG5953

DIOPT Version :9

Sequence 1:NP_001261216.1 Gene:CG3386 / 38081 FlyBaseID:FBgn0035152 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001260503.1 Gene:CG5953 / 34985 FlyBaseID:FBgn0032587 Length:701 Species:Drosophila melanogaster


Alignment Length:95 Identity:27/95 - (28%)
Similarity:49/95 - (51%) Gaps:14/95 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EFLALYQGMPELWDVHHLNYRNKELRNRAY-ELLERKLREIQPNATRTEVGRRINIFRTNYRREQ 82
            |.:..|:...|||:.....|::|..|.||: |:.||.      ..::.||.|::|:..|.||||:
  Fly    85 ELIEQYRCHTELWNRADPKYKDKLCRFRAWSEIAERF------GCSKAEVERKMNVLLTQYRREK 143

  Fly    83 MRILKQKELGLHSDLCKPTLWF----YDYM 108
            .::..:...|:..:   |:.|:    :|:|
  Fly   144 HKMFVKIYQGIQPN---PSKWYAFKRFDFM 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3386NP_001261216.1 MADF_DNA_bdg 20..111 CDD:287510 26/94 (28%)
CG5953NP_001260503.1 MADF_DNA_bdg 86..170 CDD:287510 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.