DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3386 and CG5180

DIOPT Version :9

Sequence 1:NP_001261216.1 Gene:CG3386 / 38081 FlyBaseID:FBgn0035152 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001138087.1 Gene:CG5180 / 192508 FlyBaseID:FBgn0043457 Length:355 Species:Drosophila melanogaster


Alignment Length:364 Identity:79/364 - (21%)
Similarity:132/364 - (36%) Gaps:124/364 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RQFWREFLALYQGMPELWDVHHLNYRNKELRNRAYELLERKLREIQPNATRTEVGRRINIFRTNY 78
            |.:..||:..||....||...|.:|.|...||::|:.|..||:|::||..|..|.|:||..|:.:
  Fly    10 RHWLTEFIEQYQEEECLWQPKHNDYSNHTARNKSYDRLVEKLKEVEPNPDRAMVVRKINSLRSAF 74

  Fly    79 RREQMRILKQKELGLHSDLCKPTLWFYDYMGFLLTQETFQHRTRKGRGGRQKQDFRREKDDKYPL 143
            |||..:...:.:....       ||:||.:.|:...:..:|..    |.:.|::.....||:..:
  Fly    75 RREFRKTSTKGDYATR-------LWYYDKLLFIADHKPKRHEL----GSKPKRELHISFDDEESM 128

  Fly   144 KNPDLNTESVCDWPIKDDNAFNYQSE------PTAPQ--------------SEEGSLLS-----P 183
            :..|            |.:....||:      ||:|.              |.:|:.||     |
  Fly   129 EFED------------DSHHTGTQSQHMESIIPTSPDDVEEVAATANNVVVSSQGATLSTISVTP 181

  Fly   184 K--LEIIEPEEGQC----------------------------------EVKEENSLG-------- 204
            .  :.:::.||.|.                                  :|.|..||.        
  Fly   182 AECVTLVKSEEHQAAEAAAAAAQAHQQMVAHAAAQTSIAAAAAQGHAVKVLEITSLDSNSQREIQ 246

  Fly   205 ---NSLETKEPTSSIQTDPENERGTAPMQL-----------------------------SESSEV 237
               |.||..:....:|......:|...:|:                             .:..:.
  Fly   247 QAVNHLEHHQQQLHLQQTNGQHQGVPTIQIGRDHYQPLFGNAGTTAYTTTAATSTSHRQDDEYDA 311

  Fly   238 LARSWAIQYEEMSPTQRILARKAIADILFEGCMGNLRVN 276
            :..:.|.:...::|||||:|.|.|:|:||...:|||.|:
  Fly   312 IGVNVASKLRSINPTQRIVAEKLISDVLFNAQLGNLTVH 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3386NP_001261216.1 MADF_DNA_bdg 20..111 CDD:287510 30/90 (33%)
CG5180NP_001138087.1 MADF_DNA_bdg 16..100 CDD:287510 30/90 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.