DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rev1 and RAD30

DIOPT Version :9

Sequence 1:NP_612047.1 Gene:Rev1 / 38079 FlyBaseID:FBgn0035150 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_010707.3 Gene:RAD30 / 852028 SGDID:S000002827 Length:632 Species:Saccharomyces cerevisiae


Alignment Length:642 Identity:119/642 - (18%)
Similarity:201/642 - (31%) Gaps:269/642 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 GFPKRETLKSLANSHHNCLERYVMHIDMDCFFVSVGLRTRPELRGLPIAVTHSKGGNAATDVPVH 317
            |.|.:....|||     |    :.||||:.||..|                              
Yeast    13 GSPSKAYESSLA-----C----IAHIDMNAFFAQV------------------------------ 38

  Fly   318 PQADRKAELELFAQRFEHHFHDGDKAEKVRSGFDKK-----MSLSEIASCSYEAREKGIRNGMFV 377
                                      |::|.|..|:     :..:.|.:.||.||:.||.....:
Yeast    39 --------------------------EQMRCGLSKEDPVVCVQWNSIIAVSYAARKYGISRMDTI 77

  Fly   378 GQALKLCPELKTIPY---------DFEGYKE-------------------VAFTLYDTVAQYTLN 414
            .:|||.|..|  ||.         ||..|.:                   |:...|...::..|.
Yeast    78 QEALKKCSNL--IPIHTAVFKKGEDFWQYHDGCGSWVQDPAKQISVEDHKVSLEPYRRESRKALK 140

  Fly   415 I--------EAVSCDEMFVEL---------TDLAHELNVDVM----------AFV-------SHL 445
            |        |..|.||:|::|         .|..:||..|:.          ||:       |||
Yeast   141 IFKSACDLVERASIDEVFLDLGRICFNMLMFDNEYELTGDLKLKDALSNIREAFIGGNYDINSHL 205

  Fly   446 -------------------------------------------RQEVYSKTGCPCSAGVAGNKLL 467
                                                       |..:....|...|.|::..|.:
Yeast   206 PLIPEKIKSLKFEGDVFNPEGRDLITDWDDVILALGSQVCKGIRDSIKDILGYTTSCGLSSTKNV 270

  Fly   468 ARMATKEAKPNGQFLLDSSNDILAYMAPMSLDLLP-------------GV-------------GS 506
            .::|:...||:.|.::  .||.|       ||.|.             ||             .:
Yeast   271 CKLASNYKKPDAQTIV--KNDCL-------LDFLDCGKFEITSFWTLGGVLGKELIDVLDLPHEN 326

  Fly   507 SISHKLKQAGLNNCGDVQ------------NTTLEKMEKVLGKKLGQNLFQNCRGIDDRPLAYEQ 559
            ||.| :::...:|.|.::            :.:...::.:....|.:.||:..||....||:...
Yeast   327 SIKH-IRETWPDNAGQLKEFLDAKVKQSDYDRSTSNIDPLKTADLAEKLFKLSRGRYGLPLSSRP 390

  Fly   560 IRKTVSAEMNFGIRFTNS-VECEQFLCQLSEEVTKRLVEIRRKARSINLKIMVRAAEAPVETSKY 623
            :.|::.:..|...:..|| |:|..:|.....|:|.|:.::.::...|   ::.|.....::|..|
Yeast   391 VVKSMMSNKNLRGKSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKI---VIPRTVSISLKTKSY 452

  Fly   624 MGHGVCDIINKSSLIKYATDDVNV----ITTVVLDLMKDADIPPDE-----LRGLGIHLTRLEDA 679
                  ::..||..:.|  ..:|.    :..|.:..:.|.||....     |..|.:.:|.. |.
Yeast   453 ------EVYRKSGPVAY--KGINFQSHELLKVGIKFVTDLDIKGKNKSYYPLTKLSMTITNF-DI 508

  Fly   680 NEVRKENNIKEMFG------KMSEMRKDKPIPQGAVGDKSIGDDKVNKPLVFENKPK 730
            .:::|  .:.:|||      |.|..::|              ::|.......|..||
Yeast   509 IDLQK--TVVDMFGNQVHTFKSSAGKED--------------EEKTTSSKADEKTPK 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rev1NP_612047.1 BRCT_Rev1 39..121 CDD:349351
PolY_Rev1 218..676 CDD:176455 107/580 (18%)
Rev1_C 890..985 CDD:213388
RAD30NP_010707.3 PolY_Pol_eta 27..505 CDD:176456 100/556 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.