DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED30 and MED30

DIOPT Version :9

Sequence 1:NP_612046.1 Gene:MED30 / 38078 FlyBaseID:FBgn0035149 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_542382.1 Gene:MED30 / 90390 HGNCID:23032 Length:178 Species:Homo sapiens


Alignment Length:183 Identity:68/183 - (37%)
Similarity:104/183 - (56%) Gaps:26/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PVA--GIPPGGAGGSNNMLAISQQNPHKEINIVQLSRLGQETVQDIASRFQEVFASLKGIQ---- 208
            |:|  |:.||...|.      ..|...:|:|...|.|:||||||||..|..|:|..|:.:|    
Human     5 PLAASGMAPGPFAGP------QAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNG 63

  Fly   209 PTSHRENSSEK--KVQEYFRTIRLLFKRVRIIYEKCND--AGMDYMSAESLIPYRDEP----EPR 265
            .|.|.....::  |:|:..|.:.:||:::|::|:|||:  .|||.:..|.||||.:|.    :.|
Human    64 VTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDR 128

  Fly   266 IEPS--LCDEYRKVLQENHELIETVKLKNRQLREIIDRTRIIIWEINTMLAMR 316
            ..|.  ..:|.|::.:.|.:|    |.||:||::|:|:.|.:||:||.|||||
Human   129 AGPPRFASEERREIAEVNKKL----KQKNQQLKQIMDQLRNLIWDINAMLAMR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED30NP_612046.1 Med30 178..315 CDD:288208 57/150 (38%)
MED30NP_542382.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 6/18 (33%)
Med30 29..176 CDD:402766 61/157 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141373
Domainoid 1 1.000 97 1.000 Domainoid score I7288
eggNOG 1 0.900 - - E1_28NHU
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12329
Inparanoid 1 1.050 104 1.000 Inparanoid score I4959
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549016at2759
OrthoFinder 1 1.000 - - FOG0006305
OrthoInspector 1 1.000 - - oto88491
orthoMCL 1 0.900 - - OOG6_108111
Panther 1 1.100 - - LDO PTHR31705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4589
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.