DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED30 and med30

DIOPT Version :9

Sequence 1:NP_612046.1 Gene:MED30 / 38078 FlyBaseID:FBgn0035149 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001017241.1 Gene:med30 / 549995 XenbaseID:XB-GENE-1008112 Length:184 Species:Xenopus tropicalis


Alignment Length:179 Identity:64/179 - (35%)
Similarity:104/179 - (58%) Gaps:12/179 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PVAGIPPGGAGGSNNMLAISQQNPHKEINIVQLSRLGQETVQDIASRFQEVFASLKGIQ----PT 210
            |::|...|.|.|.............:|:|...|.|:||||||||..|..|:|..|:.:|    .|
 Frog     5 PLSGPGMGAAAGPGGFPGAQAATAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVT 69

  Fly   211 SHRENSSEK--KVQEYFRTIRLLFKRVRIIYEKCND--AGMDYMSAESLIPY-RDEPEPRIEPSL 270
            .|.....::  |:||:.|.:.:||:::|::|:|||:  ||:|.:..|.|:|| .:|.....:..:
 Frog    70 YHTVTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLVPYVEEEYSKHDDRGI 134

  Fly   271 CDEYRKVLQENHELIET---VKLKNRQLREIIDRTRIIIWEINTMLAMR 316
            ..:.|...:|..|::|.   :|.||:||::|:|:.|.:||:||:|||||
 Frog   135 ASQLRFASEEKREILEVNKKLKQKNQQLKQIMDQLRNLIWDINSMLAMR 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED30NP_612046.1 Med30 178..315 CDD:288208 55/148 (37%)
med30NP_001017241.1 Med30 33..182 CDD:371462 55/148 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6744
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12329
Inparanoid 1 1.050 114 1.000 Inparanoid score I4700
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549016at2759
OrthoFinder 1 1.000 - - FOG0006305
OrthoInspector 1 1.000 - - oto102367
Panther 1 1.100 - - LDO PTHR31705
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4651
SonicParanoid 1 1.000 - - X4589
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.100

Return to query results.
Submit another query.