DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED30 and med30

DIOPT Version :9

Sequence 1:NP_612046.1 Gene:MED30 / 38078 FlyBaseID:FBgn0035149 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_957011.1 Gene:med30 / 393690 ZFINID:ZDB-GENE-040426-1676 Length:174 Species:Danio rerio


Alignment Length:187 Identity:64/187 - (34%)
Similarity:107/187 - (57%) Gaps:38/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 QQQQQLNPVAGIPPGGAGGSNNMLAISQQNPHKEINIVQLSRLGQETVQDIASRFQEVFASLKGI 207
            |||||....                       :::|...|.|:||||||||..|..|:|..|:.:
Zfish    12 QQQQQTQAA-----------------------RDVNTASLCRIGQETVQDIVLRTMEIFQLLRNM 53

  Fly   208 Q--------PTSHRENSSEKKVQEYFRTIRLLFKRVRIIYEKCND--AGMDYMSAESLIPYRDEP 262
            |        |.:|::...  |:||:.||:.:||:::|::|:|||:  ||::.:.:|.||||.::.
Zfish    54 QLPNGVTYHPNTHQDRLG--KLQEHLRTLSVLFRKLRLVYDKCNENCAGLEPIPSEQLIPYVEDD 116

  Fly   263 EPRIEPSLCDEYRKVLQENHELIET---VKLKNRQLREIIDRTRIIIWEINTMLAMR 316
            ..::|..:.::.|...:|..|::|.   :|.||:||:.|:|:.|.:|||||:|||:|
Zfish   117 SSKLEDRMANQLRAASEERREVLEVNKKLKQKNQQLKMIMDQLRNLIWEINSMLAVR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED30NP_612046.1 Med30 178..315 CDD:288208 57/149 (38%)
med30NP_957011.1 Med30 24..172 CDD:288208 57/149 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574290
Domainoid 1 1.000 112 1.000 Domainoid score I6146
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12329
Inparanoid 1 1.050 107 1.000 Inparanoid score I4902
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549016at2759
OrthoFinder 1 1.000 - - FOG0006305
OrthoInspector 1 1.000 - - otm25164
orthoMCL 1 0.900 - - OOG6_108111
Panther 1 1.100 - - LDO PTHR31705
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4651
SonicParanoid 1 1.000 - - X4589
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.