DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED30 and Med30

DIOPT Version :9

Sequence 1:NP_612046.1 Gene:MED30 / 38078 FlyBaseID:FBgn0035149 Length:318 Species:Drosophila melanogaster
Sequence 2:XP_006241708.1 Gene:Med30 / 299905 RGDID:1309369 Length:178 Species:Rattus norvegicus


Alignment Length:183 Identity:69/183 - (37%)
Similarity:105/183 - (57%) Gaps:26/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PVA--GIPPGGAGGSNNMLAISQQNPHKEINIVQLSRLGQETVQDIASRFQEVFASLKGIQ---- 208
            |:|  |:..|..||.      ..|...:|:|...|.|:||||||||..|..|:|..|:.:|    
  Rat     5 PLAPTGMASGPFGGP------QAQQAAREVNTATLCRIGQETVQDIVYRTMEIFQLLRNMQLPNG 63

  Fly   209 PTSHRENSSEK--KVQEYFRTIRLLFKRVRIIYEKCND--AGMDYMSAESLIPYRDEP----EPR 265
            .|.|.....::  |:|::.|.:.:||:::|::|:|||:  .|||.:..|.||||.||.    :.|
  Rat    64 VTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVDEDGSKNDDR 128

  Fly   266 IEPS--LCDEYRKVLQENHELIETVKLKNRQLREIIDRTRIIIWEINTMLAMR 316
            ..|.  ..:|.|::.:.|.:|    |.||:||::|:|:.|.:||:||.|||||
  Rat   129 AGPPRFASEERREIAEVNKKL----KQKNQQLKQIMDQLRNLIWDINAMLAMR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED30NP_612046.1 Med30 178..315 CDD:288208 58/150 (39%)
Med30XP_006241708.1 Med30 29..176 CDD:402766 58/150 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335042
Domainoid 1 1.000 100 1.000 Domainoid score I6865
eggNOG 1 0.900 - - E1_28NHU
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12329
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549016at2759
OrthoFinder 1 1.000 - - FOG0006305
OrthoInspector 1 1.000 - - oto95630
orthoMCL 1 0.900 - - OOG6_108111
Panther 1 1.100 - - LDO PTHR31705
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4589
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.