DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3402 and tax1bp3

DIOPT Version :9

Sequence 1:NP_612045.1 Gene:CG3402 / 38077 FlyBaseID:FBgn0035148 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_998635.1 Gene:tax1bp3 / 406779 ZFINID:ZDB-GENE-040426-2830 Length:125 Species:Danio rerio


Alignment Length:98 Identity:47/98 - (47%)
Similarity:62/98 - (63%) Gaps:12/98 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EILK--------CGFKIGGGIDQDYKKSP--QGYTDYGIYVTEVHEGSPAARAGLRIHDKILQCN 89
            ||||        .||.||||||||..::|  :...|.|||||.|.||.||..||||:.|||:|.|
Zfish    17 EILKLRDGDNLILGFSIGGGIDQDPSQNPFSEDKADKGIYVTRVSEGGPAEVAGLRVGDKIMQVN 81

  Fly    90 GYDFTMVTHKKAVSYI--RKNPILNMLVARKGV 120
            |:|.|||||.:|...:  :|..::.:|::||.:
Zfish    82 GWDMTMVTHDQARKRLTKKKEDVVRLLISRKSL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3402NP_612045.1 PDZ_signaling 21..116 CDD:238492 45/92 (49%)
tax1bp3NP_998635.1 PDZ_signaling 13..109 CDD:238492 44/91 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580165
Domainoid 1 1.000 78 1.000 Domainoid score I8737
eggNOG 1 0.900 - - E1_KOG3553
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5165
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471323at2759
OrthoFinder 1 1.000 - - FOG0007400
OrthoInspector 1 1.000 - - oto40212
orthoMCL 1 0.900 - - OOG6_108303
Panther 1 1.100 - - LDO PTHR23136
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2940
SonicParanoid 1 1.000 - - X5525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.