DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3402 and synj2bp

DIOPT Version :9

Sequence 1:NP_612045.1 Gene:CG3402 / 38077 FlyBaseID:FBgn0035148 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_956211.1 Gene:synj2bp / 334599 ZFINID:ZDB-GENE-030131-6531 Length:152 Species:Danio rerio


Alignment Length:96 Identity:33/96 - (34%)
Similarity:45/96 - (46%) Gaps:22/96 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GFKIGGGIDQDYKKSPQGYTDYGIYVTEVHEGSPAARAG-LRIHDKILQCNGYDFTMVTHKKAVS 103
            ||.|.||:||.|..:     |.||||.::.|...||..| |:..||||..||.....::|..||.
Zfish    24 GFNIVGGVDQQYMMN-----DSGIYVAKIKENGAAALDGRLQEGDKILAINGRKLDNLSHGAAVE 83

  Fly   104 Y-----------IRKNPILNMLVARKGVTST 123
            .           |::.|:|     :.|.||:
Zfish    84 LFRSAGEDVHLCIQQRPVL-----QNGPTSS 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3402NP_612045.1 PDZ_signaling 21..116 CDD:238492 30/87 (34%)
synj2bpNP_956211.1 PDZ_signaling 17..97 CDD:238492 27/77 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.